Bu şəkil, təsviri incəsənət əsərinin orijinal ikiölçülü dəqiq fotoqrafiya reproduksiyasıdır. Təsviri incəsənətin bu əsəri öz-özlüyündə aşağıdakı səbəblərdən ictimai varidat sayılır:
Public domainPublic domainfalsefalse
https://creativecommons.org/publicdomain/mark/1.0/PDMCreative Commons Public Domain Mark 1.0falsefalse
"Vikimedia Fondu" tutduğu rəsmi mövqe ondan ibarətdir ki, "ictimai varidat olan təsviri incəsənət əsərlərinin ikiölçülü dəqiq reproduksiyaları da ictimai varidat sayılır". Ətraflı məlumat almaq üçün Commons:When to use the PD-Art tag məqaləsinə baxın. Beləliklə bu fotoqrafiya reproduksiyası ictimai varidat hesab edilir. Xahiş edirik nəzərə alın ki, yerli qanunvericilikdən asılı olaraq bu məzmunun təkrar istifadəsi qadağandır və ya sizin yurisdiksiyanızda bu məzmun məhdudlaşdırılmış ola bilər. Commons:Reuse of PD-Art photographs məqaləsinə baxın.
Captions
Add a one-line explanation of what this file represents
Items portrayed in this file
təsvir edir
Portrait of Grand Duchess Maria Fiodorovna ingilis
digital representation of ingilis
Portrait of Grand Duchess Maria Fiodorovna ingilis
əsas mövzu
Portrait of Grand Duchess Maria Fiodorovna ingilis
MIME type ingilis
image/jpeg
Faylın tarixçəsi
Faylın əvvəlki versiyasını görmək üçün gün/tarix bölməsindəki tarixlərə klikləyin.
fayl, maria, fyodorovna, russia, angeli, 1874, hermitage, fayl, faylın, tarixçəsi, fayl, keçidləri, faylın, qlobal, istifadəsisınaq, göstərişi, ölçüsü, piksel, digər, ölçülər, piksel, piksel, piksel, piksel, piksel, faylın, orijinalı, 8206, piksel, fayl, həcmi. Fayl Faylin tarixcesi Fayl kecidleri Faylin qlobal istifadesiSinaq gosterisi olcusu 422 599 piksel Diger olculer 169 240 piksel 338 480 piksel 541 768 piksel 721 1 024 piksel 1 353 1 920 piksel Faylin orijinali 8206 1 353 1 920 piksel fayl hecmi 300 KB MIME novu image jpeg Bu fayl Vikimedia Commons dadirve diger layihelerde istifade edile biler tesvir sehifesi Faylin tesvir sehifesine get Xulase Heinrich von Angeli Portrait of Grand Duchess Maria Fiodorovna nbsp nbsp Artist Heinrich von Angeli nbsp 1840 1925 nbsp nbsp nbsp Alternativ adlar Heinrich von Angeli Izah Austrian ressam ve universitet muellimi Dogum olum tarixi 8 iyul 1840 nbsp 21 oktyabr 1925 nbsp Dogum olum yeri SopronVyana Yaradiciliq mekani Vyana nbsp Normativ yoxlama Q527201 VIAF 22133787 ISNI 0000000066411233 ULAN 500014667 LCCN no2014123225 GND 119067501 WorldCat creator QS P170 Q527201 nbsp Basliq ingilis Portrait of Grand Duchess Maria Fiodorovna nbsp Portrait of Grand Duchess Maria Fiodorovna 1847 1928 label QS Lru Portret velikoj knyagini Marii Fedorovny 1847 1928 label QS Lfr Portrait de la grande duchesse Marie Feodorovna 1847 1928 label QS Len Portrait of Grand Duchess Maria Fiodorovna 1847 1928 Object type resm eseri nbsp Janr portret nbsp Depicted people Mariya Fyodorovna nbsp Tarix 1874 nbsp Orta oil on canvas nbsp Olculer Hundurluk 127 sm nbsp eni 89 sm nbsp dimensions QS P2048 127 0U174728dimensions QS P2049 89 0U174728 Collection Ermitaj nbsp nbsp Native name Gosudarstvennyj Ermitazh Location Sankt Peterburq Coordinates 59 nbsp 56 nbsp 26 nbsp N 30 nbsp 18 nbsp 49 nbsp E nbsp Established 1764 nbsp Veb sayt hermitagemuseum org Normativ yoxlama Q132783 VIAF 128956287 ISNI 000000041800742X OSM 8092294 LCCN n79100241 GND 2124053 X WorldCat institution QS P195 Q132783 Accession number GE 6975 Ermitaj nbsp Place of creation Avstriya nbsp Istinadlar Hermitage Museum work ID 01 Paintings 32810 nbsp Source Photographer http www hermitagemuseum org wps portal hermitage digital collection 01 Paintings 32810 lng ru Lisenziya Bu sekil tesviri incesenet eserinin orijinal ikiolculu deqiq fotoqrafiya reproduksiyasidir Tesviri incesenetin bu eseri oz ozluyunde asagidaki sebeblerden ictimai varidat sayilir Public domain Public domain false false This work is in the public domain in its country of origin and other countries and areas where the copyright term is the author s life plus 100 years or fewer You must also include a United States public domain tag to indicate why this work is in the public domain in the United States This file has been identified as being free of known restrictions under copyright law including all related and neighboring rights https creativecommons org publicdomain mark 1 0 PDM Creative Commons Public Domain Mark 1 0 false false Vikimedia Fondu tutdugu resmi movqe ondan ibaretdir ki ictimai varidat olan tesviri incesenet eserlerinin ikiolculu deqiq reproduksiyalari da ictimai varidat sayilir Etrafli melumat almaq ucun Commons When to use the PD Art tag meqalesine baxin Belelikle bu fotoqrafiya reproduksiyasi ictimai varidat hesab edilir Xahis edirik nezere alin ki yerli qanunvericilikden asili olaraq bu mezmunun tekrar istifadesi qadagandir ve ya sizin yurisdiksiyanizda bu mezmun mehdudlasdirilmis ola biler Commons Reuse of PD Art photographs meqalesine baxin CaptionsazerbaycancaAdd a one line explanation of what this file representsItems portrayed in this filetesvir edirPortrait of Grand Duchess Maria Fiodorovna nbsp ingilisdigital representation of nbsp ingilisPortrait of Grand Duchess Maria Fiodorovna nbsp ingilisesas movzuPortrait of Grand Duchess Maria Fiodorovna nbsp ingilisMIME type nbsp ingilisimage jpeg Faylin tarixcesi Faylin evvelki versiyasini gormek ucun gun tarix bolmesindeki tarixlere klikleyin Tarix VaxtKicik sekilOlculerIstifadeciSerh indiki17 16 10 fevral 20181 353 1 920 300 KB PancoPincobigger 04 31 4 dekabr 20081 032 1 476 297 KB Dmitry Rozhkov Information Description Maria Fyodorovna Dagmar of Denmark Source http album foto ru photo 197599 Date before 1880 Author Heinrich von Angeli 1840 1925 Permission other versions Category Heinrich von Angeli Category Maria Fyod Fayl kecidleri Asagidaki sehife bu fayli istifade edir Mariya Fyodorovna Faylin qlobal istifadesi Bu fayl asagidaki vikilerde istifade olunur arz wikipedia org layihesinde istifadesi ماريا فيودوروفنا زوجه الحاكم من الامبراطوريه الروسيه be wikipedia org layihesinde istifadesi Maryya Fyodarayna zhonka Alyaksandra III bg wikipedia org layihesinde istifadesi Mariya Fodorovna Dagmar Datska Chokr ca wikipedia org layihesinde istifadesi Dagmar de Dinamarca Gran Duc cs wikipedia org layihesinde istifadesi Seznam manzelek panovniku Finska cy wikipedia org layihesinde istifadesi Maria Feodorovna da wikipedia org layihesinde istifadesi Christian 9 Diskussion Europas svigerfar Christian IX Diskussion Europas svigerfar Bruger Steenth Autoliste gravsted dk Wikipedia WikiProjekt Kvinder lister Dansk Kvindebiografisk Leksikon en wikipedia org layihesinde istifadesi Grand duke List of Finnish royal consorts User Arz User Jane023 Paintings in the Hermitage User Emijrp List of women painters User Jane023 Top women born before 1900 eo wikipedia org layihesinde istifadesi Maria Fjodorovna es wikipedia org layihesinde istifadesi Gran duque eu wikipedia org layihesinde istifadesi Maria Feodorovna Dagmar Danimarkakoa fa wikipedia org layihesinde istifadesi دوک بزرگ fi wikipedia org layihesinde istifadesi Kayttaja Susannaanas Naiset Kansallisbiografia kuvat fr wikipedia org layihesinde istifadesi Grand duc gl wikipedia org layihesinde istifadesi Gran Duque Wikipedia Lista de mulleres con artigo na Wikipedia en galego hy wikipedia org layihesinde istifadesi Մարիա Ֆեոդորովնա Դագմար id wikipedia org layihesinde istifadesi Maria Feodorovna 1847 1928 Adipati agung la wikipedia org layihesinde istifadesi Maria Theodori filia iunior nl wikipedia org layihesinde istifadesi Gebruiker RonnieV Lijst van personen geboren in 1847 Gebruiker RonnieV Lijst van personen geboren op 26 november Gebruiker RonnieV Lijst van personen overleden in 1928 Gebruiker RonnieV Lijst van personen overleden op 13 oktober Gebruiker RonnieBot afbeeldingen 15 1000 Gebruiker RonnieV Kunstenaars overleden in 1928 Gebruiker RonnieV Kunstschilders overleden in 1928 pl wikipedia org layihesinde istifadesi Dyskusja wikiprojektu Rocznice ekspozycje 11 26 Modul Kalendarium 11 26 ru wikipedia org layihesinde istifadesi Mariya Fyodorovna zhena Aleksandra III Choker ru wikinews org layihesinde istifadesi Kategoriya Mariya Fyodorovna zhena Aleksandra III sr wikipedia org layihesinde istifadesi Finske vladarke tg wikipedia org layihesinde istifadesi Mariya Fyodorovna ҳamsari Aleksandri III th wikipedia org layihesinde istifadesi rayphranamkhuxphiesksmrsinphramhakstriyfinaelnd tr wikipedia org layihesinde istifadesi Granduk www wikidata org layihesinde istifadesi Q153601 Q27978644 Wikidata WikiProject Women Portraits of Women 1870 1879 Bu faylin qlobal istifadesine baxin Menbe https az wikipedia org wiki Fayl Maria Fyodorovna of Russia by H von Angeli 1874 Hermitage jpg, wikipedia, oxu, kitab, kitabxana, axtar, tap, hersey,
ne axtarsan burda
, en yaxsi meqale sayti, meqaleler, kitablar, oyrenmek, wiki, bilgi, tarix, seks, porno, indir, yukle, sex, azeri sex, azeri, seks yukle, sex yukle, izle, seks izle, porno izle, mobil seks, telefon ucun, chat, azeri chat, tanisliq, tanishliq, azeri tanishliq, sayt, medeni, medeni saytlar, chatlar, mekan, tanisliq mekani, mekanlari, yüklə, pulsuz, pulsuz yüklə, mp3, video, mp4, 3gp, jpg, jpeg, gif, png, şəkil, muisiqi, mahnı, kino, film, kitab, oyun, oyunlar.
.jpg.html){kind=link}