fbpx
Wikipedia

Shah Jahan I of India

Faylın orijinalı(619 × 874 piksel, fayl həcmi: 134 KB, MIME növü: image/jpeg)

Bu fayl "Vikimedia Commons"dadır
və digər layihələrdə istifadə edilə bilər.
təsvir səhifəsi
Faylın təsvir səhifəsinə get

Xülasə

İzah
English: Shah Jahan I of India.
Tarix circa 1630
date QS:P,+1630-00-00T00:00:00Z/9,P1480,Q5727902
Mənbə Cropped from File:Emperor Shah Jahan (r. 1628-1658) (verso), Calligraphy (recto), Folio from the Late Shah Jahan album LACMA M.78.9.15 (1 of 3).jpg
Müəllif Bichitr

Lisenziya

Bu şəkil, təsviri incəsənət əsərinin orijinal ikiölçülü dəqiq fotoqrafiya reproduksiyasıdır. Təsviri incəsənətin bu əsəri öz-özlüyündə aşağıdakı səbəblərdən ictimai varidat sayılır:
"Vikimedia Fondu" tutduğu rəsmi mövqe ondan ibarətdir ki, "ictimai varidat olan təsviri incəsənət əsərlərinin ikiölçülü dəqiq reproduksiyaları da ictimai varidat sayılır". Ətraflı məlumat almaq üçün Commons:When to use the PD-Art tag məqaləsinə baxın.
Beləliklə bu fotoqrafiya reproduksiyası ictimai varidat hesab edilir. Xahiş edirik nəzərə alın ki, yerli qanunvericilikdən asılı olaraq bu məzmunun təkrar istifadəsi qadağandır və ya sizin yurisdiksiyanızda bu məzmun məhdudlaşdırılmış ola bilər. Commons:Reuse of PD-Art photographs məqaləsinə baxın.

Faylın tarixçəsi

Faylın əvvəlki versiyasını görmək üçün gün/tarix bölməsindəki tarixlərə klikləyin.

Tarix/VaxtKiçik şəkilÖlçülərİstifadəçiŞərh
indiki10:51, 25 noyabr 2013619 × 874 (134 KB)TRAJAN 117Changed to full size portrait.
18:15, 11 noyabr 20131.133 × 1.565 (416 KB)TRAJAN 117User created page with UploadWizard

Aşağıdakı səhifə bu faylı istifadə edir:

Faylın qlobal istifadəsi

Bu fayl aşağıdakı vikilərdə istifadə olunur:

  • মুঘল সম্রাট
  • Dinastía timúrida
  • Emperador mogol
  • मुग़ल शासकों की सूची
  • भारतीय सम्राटों की सूची
  • hi.wikibooks.org layihəsində istifadəsi
    • मध्यकालीन भारत/मुग़ल वंश
  • Daftar Kaisar Mughal
  • مغل بادشاہاں دی لسٹ
  • مغل بادشاہ
  • ہندوستان دے مسلمان حکمراناں دی تریخ
  • ترک سلطنتاں تے ریاستاں دی تریخ
  • Metaməlumatlar

    fayl, shah, jahan, india, fayl, faylın, tarixçəsi, fayl, keçidləri, faylın, qlobal, istifadəsi, metaməlumatlarsınaq, göstərişi, ölçüsü, piksel, digər, ölçülər, piksel, piksel, faylın, orijinalı, 8206, piksel, fayl, həcmi, mime, növü, image, jpeg, fayl, vikimed. Fayl Faylin tarixcesi Fayl kecidleri Faylin qlobal istifadesi MetamelumatlarSinaq gosterisi olcusu 424 599 piksel Diger olculer 170 240 piksel 619 874 piksel Faylin orijinali 8206 619 874 piksel fayl hecmi 134 KB MIME novu image jpeg Bu fayl Vikimedia Commons dadirve diger layihelerde istifade edile biler tesvir sehifesi Faylin tesvir sehifesine get Xulase IzahShah Jahan I of India jpg English Shah Jahan I of India Tarix circa 1630 date QS P 1630 00 00T00 00 00Z 9 P1480 Q5727902 Menbe Cropped from File Emperor Shah Jahan r 1628 1658 verso Calligraphy recto Folio from the Late Shah Jahan album LACMA M 78 9 15 1 of 3 jpg Muellif Bichitr Lisenziya Bu sekil tesviri incesenet eserinin orijinal ikiolculu deqiq fotoqrafiya reproduksiyasidir Tesviri incesenetin bu eseri oz ozluyunde asagidaki sebeblerden ictimai varidat sayilir Public domain Public domain false false This work is in the public domain in its country of origin and other countries and areas where the copyright term is the author s life plus 100 years or fewer You must also include a United States public domain tag to indicate why this work is in the public domain in the United States This file has been identified as being free of known restrictions under copyright law including all related and neighboring rights https creativecommons org publicdomain mark 1 0 PDM Creative Commons Public Domain Mark 1 0 false false Vikimedia Fondu tutdugu resmi movqe ondan ibaretdir ki ictimai varidat olan tesviri incesenet eserlerinin ikiolculu deqiq reproduksiyalari da ictimai varidat sayilir Etrafli melumat almaq ucun Commons When to use the PD Art tag meqalesine baxin Belelikle bu fotoqrafiya reproduksiyasi ictimai varidat hesab edilir Xahis edirik nezere alin ki yerli qanunvericilikden asili olaraq bu mezmunun tekrar istifadesi qadagandir ve ya sizin yurisdiksiyanizda bu mezmun mehdudlasdirilmis ola biler Commons Reuse of PD Art photographs meqalesine baxin Public domain Public domain false false This file is in the public domain because it has been released by the Los Angeles County Museum of Art www lacma org with its Public Domain High Resolution Image Available mark LACMA is unaware of any current copyright restrictions on Content so designated either because i the term of copyright has expired ii no evidence has been found that copyright restrictions apply or iii because LACMA owns copyright but would like to share this Content with the public without exercising control as part of its mission to engage and educate its communities LACMA does not warrant that the sharing of this Content will not infringe upon the rights of third parties holding rights to these works For more information see the LACMA Image Library Terms and Conditions Deutsch nbsp English nbsp francais nbsp 日本語 nbsp Faylin tarixcesi Faylin evvelki versiyasini gormek ucun gun tarix bolmesindeki tarixlere klikleyin Tarix VaxtKicik sekilOlculerIstifadeciSerh indiki10 51 25 noyabr 2013619 874 134 KB TRAJAN 117Changed to full size portrait 18 15 11 noyabr 20131 133 1 565 416 KB TRAJAN 117User created page with UploadWizard Fayl kecidleri Asagidaki sehife bu fayli istifade edir Boyuk Mogol imperiyasi hokmdarlarinin siyahisi Faylin qlobal istifadesi Bu fayl asagidaki vikilerde istifade olunur bn wikipedia org layihesinde istifadesi ম ঘল স ম র জ য ম ঘল সম র ট br wikipedia org layihesinde istifadesi Impalaerien Vogol cs wikipedia org layihesinde istifadesi Seznam mughalskych cisaru en wikipedia org layihesinde istifadesi Dano Mughal War es wikipedia org layihesinde istifadesi Imperio mogol Dinastia timurida Emperador mogol fa wikipedia org layihesinde istifadesi فهرست پادشاهان گورکانی هند fr wikipedia org layihesinde istifadesi Liste des empereurs moghols hi wikipedia org layihesinde istifadesi म ग ल स म र ज य म ग ल श सक क स च भ रत य सम र ट क स च hi wikibooks org layihesinde istifadesi मध यक ल न भ रत म ग ल व श id wikipedia org layihesinde istifadesi Kekaisaran Mughal 1526 1857 Daftar Kaisar Mughal ja wikipedia org layihesinde istifadesi シャー ジャハーン ko wikipedia org layihesinde istifadesi 무굴 황제 mr wikipedia org layihesinde istifadesi म गल ne wikipedia org layihesinde istifadesi म गल स म र ज य pa wikipedia org layihesinde istifadesi ਮ ਗ ਲ ਬ ਦਸ ਹ pnb wikipedia org layihesinde istifadesi مغلیا سلطنت مغل بادشاہاں دی لسٹ مغل بادشاہ ہندوستان دے مسلمان حکمراناں دی تریخ ترک سلطنتاں تے ریاستاں دی تریخ pt wikipedia org layihesinde istifadesi Lista de imperadores mogois sl wikipedia org layihesinde istifadesi Mogulski cesarji ta wikipedia org layihesinde istifadesi ம கல யப ப ரரச th wikipedia org layihesinde istifadesi rayphranamckrphrrdiaehngckrwrrdiomkul tr wikipedia org layihesinde istifadesi Babur Imparatorlugu hukumdarlari ur wikipedia org layihesinde istifadesi مغلیہ سلطنت کے حکمرانوں کی فہرستMetamelumatlar Bu faylda fotoaparat ve ya skanerle elave olunmus melumatlar var Eger fayl sonradan redakte olunubsa bezi parametrler bu sekilde gosterilenlerden ferqli ola biler OrientasiyaNormalFaylin deyismesi tarixi ve vaxti10 39 25 noyabr 2013Unique image ID7EE2885EB6A14529917AB1D42E714A27Proqram teminatiMicrosoft Windows Photo Gallery 6 0 6000 16386 Menbe https az wikipedia org wiki Fayl Shah Jahan I of India jpg, wikipedia, oxu, kitab, kitabxana, axtar, tap, hersey,

    ne axtarsan burda

    , en yaxsi meqale sayti, meqaleler, kitablar, oyrenmek, wiki, bilgi, tarix, seks, porno, indir, yukle, sex, azeri sex, azeri, seks yukle, sex yukle, izle, seks izle, porno izle, mobil seks, telefon ucun, chat, azeri chat, tanisliq, tanishliq, azeri tanishliq, sayt, medeni, medeni saytlar, chatlar, mekan, tanisliq mekani, mekanlari, yüklə, pulsuz, pulsuz yüklə, mp3, video, mp4, 3gp, jpg, jpeg, gif, png, şəkil, muisiqi, mahnı, kino, film, kitab, oyun, oyunlar.