fbpx
Wikipedia

Philippe IV le Bel

Faylın orijinalı(1.645 × 2.350 piksel, fayl həcmi: 1,91 MB, MIME növü: image/jpeg)

Bu fayl "Vikimedia Commons"dadır
və digər layihələrdə istifadə edilə bilər.
Faylın təsvir səhifəsinə get
Français : Philippe IV le Bel d'après le Recueil des rois de France de Jean Du TilletEnglish: Philippe IV le Bel From Recueil des rois de France, by Jean Du Tillet (16th century).   (  )
Artist
AnonymousUnknown author
Başlıq
Français : Philippe IV le Bel d'après le Recueil des rois de France de Jean Du Tillet
English: Philippe IV le Bel From Recueil des rois de France, by Jean Du Tillet (16th century).
İzah
Français : Peinture réalisée d'après l'image gravée sur le grand sceau du roi. Un médaillon, au milieu de la partie inférieure de la bordure, présente l'image du contre-sceau royal
Tarix 16 century
date QS:P571,+1550-00-00T00:00:00Z/7
Orta illumination on parchment
institution QS:P195,Q193563
Accession number
FR 2848, f. 150
Source/Photographer Not necessary, PD by age.



Bu şəkil, təsviri incəsənət əsərinin orijinal ikiölçülü dəqiq fotoqrafiya reproduksiyasıdır. Təsviri incəsənətin bu əsəri öz-özlüyündə aşağıdakı səbəblərdən ictimai varidat sayılır:
"Vikimedia Fondu" tutduğu rəsmi mövqe ondan ibarətdir ki, "ictimai varidat olan təsviri incəsənət əsərlərinin ikiölçülü dəqiq reproduksiyaları da ictimai varidat sayılır". Ətraflı məlumat almaq üçün Commons:When to use the PD-Art tag məqaləsinə baxın.
Beləliklə bu fotoqrafiya reproduksiyası ictimai varidat hesab edilir. Xahiş edirik nəzərə alın ki, yerli qanunvericilikdən asılı olaraq bu məzmunun təkrar istifadəsi qadağandır və ya sizin yurisdiksiyanızda bu məzmun məhdudlaşdırılmış ola bilər. Commons:Reuse of PD-Art photographs məqaləsinə baxın.

Captions

Add a one-line explanation of what this file represents
Philip IV ''The Fair''

Items portrayed in this file

təsvir edir

Faylın tarixçəsi

Faylın əvvəlki versiyasını görmək üçün gün/tarix bölməsindəki tarixlərə klikləyin.

Tarix/VaxtKiçik şəkilÖlçülərİstifadəçiŞərh
indiki09:48, 9 aprel 20131.645 × 2.350 (1,91 MB)Il Dottorebq from Gallica
20:02, 20 avqust 2005482 × 655 (91 KB)PetrusbarbygerePhilippe IV le Bel Source: Bibliothèque Nationale de france {{PD-art}} Category:French monarchs\
13:30, 9 aprel 2005512 × 673 (140 KB)PetrusbarbygerePhilippe IV le Bel Bibliothèque Nationale de France {{PD-art}} Category:French monarchs

Bu faylı istifadə edən səhifə yoxdur.

Faylın qlobal istifadəsi

Bu fayl aşağıdakı vikilərdə istifadə olunur:

  • Филип IV (Франция)
  • Roll ar rouaned c'hall
  • Rouaned Navarra
  • Giovanni Villani
  • Papado en Avinjono
  • Felipe IV de Francia
  • Blanca de Artois
  • Nesle dorreko gertaera
  • Ordre du Temple
  • Philippe IV le Bel
  • États généraux de 1302-1303
  • Esmans
  • Papauté d'Avignon
  • Clos aux galées
  • Procès de l'ordre du Temple
  • Saison 15 de Secrets d'histoire
  • Utilisateur:L0Ldu82/Brouillon
  • fr.wikiversity.org layihəsində istifadəsi
    • Recherche:Pastech/243-1 Canon à poudre
  • Filippo IV di Francia
  • Europa nei secoli XIV e XV
  • Cavalieri templari
  • ナバラ君主一覧
  • User:巫恒/皇家肖像馆/君主画像
  • Metaməlumatlar

    fayl, philippe, fayl, faylın, tarixçəsi, istifadə, edilən, səhifələr, faylın, qlobal, istifadəsi, metaməlumatlarsınaq, göstərişi, ölçüsü, piksel, digər, ölçülər, piksel, piksel, piksel, piksel, piksel, faylın, orijinalı, 8206, piksel, fayl, həcmi, mime, növü, . Fayl Faylin tarixcesi Istifade edilen sehifeler Faylin qlobal istifadesi MetamelumatlarSinaq gosterisi olcusu 420 600 piksel Diger olculer 168 240 piksel 336 480 piksel 537 768 piksel 717 1 024 piksel 1 645 2 350 piksel Faylin orijinali 8206 1 645 2 350 piksel fayl hecmi 1 91 MB MIME novu image jpeg Bu fayl Vikimedia Commons dadirve diger layihelerde istifade edile biler Faylin tesvir sehifesine get Francais Philippe IV le Bel d apres le Recueil des rois de France de Jean Du TilletEnglish Philippe IV le Bel From Recueil des rois de France by Jean Du Tillet 16th century Artist Anonymous Unknown authorBasliq Francais Philippe IV le Bel d apres le Recueil des rois de France de Jean Du TilletEnglish Philippe IV le Bel From Recueil des rois de France by Jean Du Tillet 16th century Izah Francais Peinture realisee d apres l image gravee sur le grand sceau du roi Un medaillon au milieu de la partie inferieure de la bordure presente l image du contre sceau royalTarix 16 century date QS P571 1550 00 00T00 00 00Z 7Orta illumination on parchmentCollection Fransa milli kitabxanasi Native name Bibliotheque nationale de France Parent institution Fransa Medeniyyet Nazirliyi Location Parisin 2 ci rayonu FransaCoordinates 48 50 01 N 2 22 33 E Established 1368Veb sehife catalogue bnf fr Normativ yoxlama Q193563 VIAF 137156173 ISNI 0000 0001 2353 1945 ULAN 500309981 LCCN no95028191 GND 5156217 0 WorldCat institution QS P195 Q193563Accession number FR 2848 f 150Source Photographer Not necessary PD by age Bu sekil tesviri incesenet eserinin orijinal ikiolculu deqiq fotoqrafiya reproduksiyasidir Tesviri incesenetin bu eseri oz ozluyunde asagidaki sebeblerden ictimai varidat sayilir Public domain Public domain false falseThis work is in the public domain in its country of origin and other countries and areas where the copyright term is the author s life plus 100 years or fewer You must also include a United States public domain tag to indicate why this work is in the public domain in the United States This file has been identified as being free of known restrictions under copyright law including all related and neighboring rights https creativecommons org publicdomain mark 1 0 PDM Creative Commons Public Domain Mark 1 0 false false Vikimedia Fondu tutdugu resmi movqe ondan ibaretdir ki ictimai varidat olan tesviri incesenet eserlerinin ikiolculu deqiq reproduksiyalari da ictimai varidat sayilir Etrafli melumat almaq ucun Commons When to use the PD Art tag meqalesine baxin Belelikle bu fotoqrafiya reproduksiyasi ictimai varidat hesab edilir Xahis edirik nezere alin ki yerli qanunvericilikden asili olaraq bu mezmunun tekrar istifadesi qadagandir ve ya sizin yurisdiksiyanizda bu mezmun mehdudlasdirilmis ola biler Commons Reuse of PD Art photographs meqalesine baxin CaptionsazerbaycancaAdd a one line explanation of what this file representsingilisPhilip IV The Fair ispanFelipe IV El Hermoso katalanFelip IV El Bell fransizPhilippe IV Le Bel Items portrayed in this filetesvir edir Faylin tarixcesi Faylin evvelki versiyasini gormek ucun gun tarix bolmesindeki tarixlere klikleyin Tarix VaxtKicik sekilOlculerIstifadeciSerh indiki09 48 9 aprel 20131 645 2 350 1 91 MB Il Dottorebq from Gallica 20 02 20 avqust 2005482 655 91 KB PetrusbarbygerePhilippe IV le Bel Source Bibliotheque Nationale de france PD art Category French monarchs 13 30 9 aprel 2005512 673 140 KB PetrusbarbygerePhilippe IV le Bel Bibliotheque Nationale de France PD art Category French monarchs Istifade edilen sehifeler Bu fayli istifade eden sehife yoxdur Faylin qlobal istifadesi Bu fayl asagidaki vikilerde istifade olunur an wikipedia org layihesinde istifadesi Lista de reis de Francia ast wikipedia org layihesinde istifadesi Felipe IV de Francia bg wikipedia org layihesinde istifadesi Kral na Franciya Filip IV Franciya br wikipedia org layihesinde istifadesi 29 Du Roll ar rouaned c hall Rouaned Navarra ca wikipedia org layihesinde istifadesi Home cs wikipedia org layihesinde istifadesi Seznam nejdele vladnoucich francouzskych panovniku de wikipedia org layihesinde istifadesi St Pierre Le Dorat en wikipedia org layihesinde istifadesi Philip IV of France Giovanni Villani eo wikipedia org layihesinde istifadesi Giovanni Villani Papado en Avinjono es wikipedia org layihesinde istifadesi Varon Felipe IV de Francia Blanca de Artois eu wikipedia org layihesinde istifadesi Zerrenda Frantziako errege erreginak Nesle dorreko gertaera fr wikipedia org layihesinde istifadesi Grand Schisme d Occident Ordre du Temple Philippe IV le Bel Etats generaux de 1302 1303 Esmans Papaute d Avignon Clos aux galees Proces de l ordre du Temple Saison 15 de Secrets d histoire Utilisateur L0Ldu82 Brouillon fr wikiversity org layihesinde istifadesi Recherche Pastech 243 1 Canon a poudre hu wikipedia org layihesinde istifadesi Navarra uralkodoinak listaja id wikipedia org layihesinde istifadesi Giovanni Villani it wikipedia org layihesinde istifadesi Cattivita avignonese Filippo IV di Francia Europa nei secoli XIV e XV Cavalieri templari ja wikipedia org layihesinde istifadesi フィリップ4世 フランス王 ナバラ君主一覧 lt wikipedia org layihesinde istifadesi Prancuzijos karalius ru wikipedia org layihesinde istifadesi Spisok umershih v 1314 godu scn wikipedia org layihesinde istifadesi Re di Francia sl wikipedia org layihesinde istifadesi Viennski koncil th wikipedia org layihesinde istifadesi rayphranamphramhakstriyaelackrphrrdifrngess vi wikipedia org layihesinde istifadesi Philippe IV của Phap www wikidata org layihesinde istifadesi Talk Q18384454 zh wikipedia org layihesinde istifadesi User Vanished user 211120 沙盒 User 巫恒 皇家肖像馆 君主画像Metamelumatlar Bu faylda fotoaparat ve ya skanerle elave olunmus melumatlar var Eger fayl sonradan redakte olunubsa bezi parametrler bu sekilde gosterilenlerden ferqli ola biler OrientasiyaNormalUfuqi xett72 dpiSaquli xett72 dpiProqram teminatiAdobe Photoshop CS5 WindowsFaylin deyismesi tarixi ve vaxti12 48 9 aprel 2013Reng sahesiFotosekilde reng secimi edilmemisdir Tarix ve vaxt reqemlesdirilir23 57 1 aprel 2013Date metadata was last modified15 48 9 aprel 2013Unique ID of original documentxmp did E236754EF9A0E21188B7855D21FD763E Menbe https az wikipedia org wiki Fayl Philippe IV le Bel jpg, wikipedia, oxu, kitab, kitabxana, axtar, tap, hersey,

    ne axtarsan burda

    , en yaxsi meqale sayti, meqaleler, kitablar, oyrenmek, wiki, bilgi, tarix, seks, porno, indir, yukle, sex, azeri sex, azeri, seks yukle, sex yukle, izle, seks izle, porno izle, mobil seks, telefon ucun, chat, azeri chat, tanisliq, tanishliq, azeri tanishliq, sayt, medeni, medeni saytlar, chatlar, mekan, tanisliq mekani, mekanlari, yüklə, pulsuz, pulsuz yüklə, mp3, video, mp4, 3gp, jpg, jpeg, gif, png, şəkil, muisiqi, mahnı, kino, film, kitab, oyun, oyunlar.