Bu fayl "Vikimedia Commons"dadır və digər layihələrdə istifadə edilə bilər.
Faylın təsvir səhifəsinə get
Xülasə
İzahHuman Body 02.png
English: female (left) and male (right) human body seen from front and back
Tarix
(UTC)
Mənbə
This file was derived from: Human Body.jpg:
Müəllif
Human_Body.jpg: Mikael Häggström
derivative work: Parzi
Bu təsvirin redaktəsi, orijinala əsaslanaraq rəqəmsal qaydadadır. Dəyişiklik: Toenails of the woman no longer painted red. (Based on version 23:32, 10. Dez. 2011 of Human Body.jpg). İlkin təsvir buradadır: Human Body.jpg. Redaktə etdi Parzi.
Lisenziya
I, the copyright holder of this work, hereby publish it under the following licenses:
This file is made available under the Creative Commons CC0 1.0 Universal Public Domain Dedication.
The person who associated a work with this deed has dedicated the work to the public domain by waiving all of their rights to the work worldwide under copyright law, including all related and neighboring rights, to the extent allowed by law. You can copy, modify, distribute and perform the work, even for commercial purposes, all without asking permission.
http://creativecommons.org/publicdomain/zero/1.0/deed.enCC0Creative Commons Zero, Public Domain Dedicationfalsefalse
Public domainPublic domainfalsefalse
İstədiyiniz lisenziyanı seçə bilərsiniz.
Orijinal yükləmə gündəliyi
This image is a derivative work of the following images:
File:Human_Body.jpg licensed with Cc-zero, PD-self
2013-12-05T14:47:45Z Hic et nunc 5121x9791 (6863790 Bytes) nail polish and ear pearcing removed
fayl, human, body, fayl, faylın, tarixçəsi, istifadə, edilən, səhifələr, faylın, qlobal, istifadəsisınaq, göstərişi, ölçüsü, piksel, digər, ölçülər, piksel, piksel, piksel, piksel, piksel, piksel, faylın, orijinalı, 8206, piksel, fayl, həcmi, mime, növü, image. Fayl Faylin tarixcesi Istifade edilen sehifeler Faylin qlobal istifadesiSinaq gosterisi olcusu 313 598 piksel Diger olculer 125 240 piksel 251 480 piksel 401 768 piksel 535 1 024 piksel 1 071 2 048 piksel 5 121 9 791 piksel Faylin orijinali 8206 5 121 9 791 piksel fayl hecmi 19 42 MB MIME novu image png Bu fayl Vikimedia Commons dadirve diger layihelerde istifade edile biler Faylin tesvir sehifesine get Xulase IzahHuman Body 02 png English female left and male right human body seen from front and back Tarix 6 dekabr 2013 15 55 UTC Menbe This file was derived from Human Body jpg Muellif Human Body jpg Mikael Haggstrom derivative work Parzi Bu tesvirin redaktesi orijinala esaslanaraq reqemsal qaydadadir Deyisiklik Toenails of the woman no longer painted red Based on version 23 32 10 Dez 2011 of Human Body jpg Ilkin tesvir buradadir Human Body jpg Redakte etdi Parzi Lisenziya I the copyright holder of this work hereby publish it under the following licenses This file is made available under the Creative Commons CC0 1 0 Universal Public Domain Dedication The person who associated a work with this deed has dedicated the work to the public domain by waiving all of their rights to the work worldwide under copyright law including all related and neighboring rights to the extent allowed by law You can copy modify distribute and perform the work even for commercial purposes all without asking permission http creativecommons org publicdomain zero 1 0 deed en CC0 Creative Commons Zero Public Domain Dedication false falsePublic domain Public domain false falseMen bu eserin muellif huquqlarinin sahibi kimi eseri ictimai mulkiyyete verirem Bu icaze butun dunyada quvvededir In some countries this may not be legally possible if so Bunun qanunla mumkun olmadigi hallarda Istenilen sexse istenilen meqsed ucun qanunlar terefinden qadagan edilmeyince hec bir sert qoymadan bu isden istifade haqqini bagislayiram Istediyiniz lisenziyani sece bilersiniz Orijinal yukleme gundeliyi This image is a derivative work of the following images File Human Body jpg licensed with Cc zero PD self 2013 12 05T14 47 45Z Hic et nunc 5121x9791 6863790 Bytes nail polish and ear pearcing removed 2011 12 10T22 32 00Z Lamilli 5121x9791 6686878 Bytes int filedesc Information Description Source File Anterior view of human female retouched jpg File Anterior view of human male retouched jpg File Posterior view of human female retouched jpgUploaded with derivativeFXCaptionsazerbaycancaAdd a one line explanation of what this file representsingilisfemale left and male right human body seen from front and backalmanweiblicher und mannlicher Mensch jeweils von vorne und hintenItems portrayed in this filetesvir edirInsan anatomiyasikisicilpaqliqinsanqadinanterior ingilisposterior ingilisfront ingilisback ingiliscopyright status ingiliscopyrighted dedicated to the public domain by copyright holder ingilislisenziyareleased into the public domain by the copyright holder ingilisCC0 ingilisyaranma tarixi6 dekabr 2013 Faylin tarixcesi Faylin evvelki versiyasini gormek ucun gun tarix bolmesindeki tarixlere klikleyin Tarix VaxtKicik sekilOlculerIstifadeciSerh indiki19 29 6 dekabr 20135 121 9 791 19 42 MB ParziOhrstecker mit Hilfe einer Bilderversion von Benutzer Hic et nunc entfernt Stud deleted with a picture version of user Hic et nunc 16 10 6 dekabr 20135 121 9 791 19 42 MB Parzi Information Description en 1 b Source b Author b Date Permission other versions Istifade edilen sehifeler Bu sekile olan kecidler Insan bedeni Faylin qlobal istifadesi Bu fayl asagidaki vikilerde istifade olunur bcl wikipedia org layihesinde istifadesi Lawas nin tawo cv wikipedia org layihesinde istifadesi Etem ӳt pĕvĕ de wikipedia org layihesinde istifadesi Mensch Menschlicher Korper Wikipedia Fotowerkstatt Archiv 2013 Dezember Diskussion Mensch Archiv 3 Diskussion Geschlechtergerechte Sprache Archiv 2021 1 el wikipedia org layihesinde istifadesi An8rwpino swma en wikipedia org layihesinde istifadesi Human body fa wikipedia org layihesinde istifadesi بدن انسان ویژگی های جنسی ga wikipedia org layihesinde istifadesi Corp an duine incubator wikimedia org layihesinde istifadesi Wt kbd pky Wp kck Mbili Wenhu Wt kbd ӏepklepk Wp mnc ᠪᡝᠶᡝ ja wikipedia org layihesinde istifadesi 裸 meta wikimedia org layihesinde istifadesi Wiki99 COVID 19 mk wikipedia org layihesinde istifadesi Chovechko telo ml wikipedia org layihesinde istifadesi മന ഷ യ ശര ര pt wikipedia org layihesinde istifadesi Corpo humano Humano Usuario EduardoFP7 Testes 1 uz wikipedia org layihesinde istifadesi Inson tanasi www wikidata org layihesinde istifadesi Q23852 yi wikipedia org layihesinde istifadesi מענטש yo wikipedia org layihesinde istifadesi Ẹ ya ara Eniyan zh wikipedia org layihesinde istifadesi 人体 Menbe https az wikipedia org wiki Fayl Human Body 02 png, wikipedia, oxu, kitab, kitabxana, axtar, tap, hersey,
ne axtarsan burda
, en yaxsi meqale sayti, meqaleler, kitablar, oyrenmek, wiki, bilgi, tarix, seks, porno, indir, yukle, sex, azeri sex, azeri, seks yukle, sex yukle, izle, seks izle, porno izle, mobil seks, telefon ucun, chat, azeri chat, tanisliq, tanishliq, azeri tanishliq, sayt, medeni, medeni saytlar, chatlar, mekan, tanisliq mekani, mekanlari, yüklə, pulsuz, pulsuz yüklə, mp3, video, mp4, 3gp, jpg, jpeg, gif, png, şəkil, muisiqi, mahnı, kino, film, kitab, oyun, oyunlar.
