Bu fayl "Vikimedia Commons"dadır və digər layihələrdə istifadə edilə bilər.
Faylın təsvir səhifəsinə get
Xülasə
İzahFeynmann Diagram Gluon Radiation.svg
English: A Feynman diagram showing the radiation of a gluon when an electron and positron are annihilated.
Deutsch: Ein Feynman-Diagramm, dass die Strahlung eines Gluons bei Annihilation eines Elektrons und eines Positrons darstellt.
Español: Un diagrama de Feynman mostrando la producción de un gluón cuando un electrón y un positrón son aniquilados.
Français : Émission d'un gluon lors de l'annihilation d'un électron et d'un positron.
Tarix
Mənbə
Non-Derived SVG of Radiate gluon.png, originally the work of SilverStar at Feynmann-diagram-gluon-radiation.svg, updated by joelholdsworth.
Müəllif
Joel Holdsworth (Joelholdsworth)
İcazə (Faylın təkrar istifadəsi)
Public domainPublic domainfalsefalse
SVG genesis
InfoField
The SVG code is valid.
This diagram was created with unknown tool.
This diagram uses embedded text that can be easily translated using a text editor.
Captions
Add a one-line explanation of what this file represents
A Feynman diagram describing gluon radiation in which an electron (e-) and a positron (e+) collide, form a photon (γ) before decaying into an anti quark/quark pair.Eventually, the anti quark releases a gluon.
A Fundamental Feynman Diagram (sequence described below)
湮灭
صورة تخطيطية لمخطط فاينمان ، حيث يبين التآثر الشديد بين الإلكترونات و الكواركات و ضديداتها
Dessin crée par Feynmann , pour indiquer les réactions entre les éléctrons et les Quarks
The arrow of time points in the wrong direction. Look at the arrows on the electron and positron: they're not annihilating, the electron is interacting with the quark.
make t for time italic (it's a variable), also convert gamma for photon to times new roman in curves (not as text) - clearer and nicer to see it that way rather than the hideous default font
==Summary== A Feynmann diagram showing the radiation of a gluon when an electron and positron are annihalated. Non-Derived SVG of Image:Radiate_gluon.png, originally the work of de:User:SilverStar, updated by User:joelholdsworth. == Lice
==Summary== A Feynmann diagram showing the radiation of a gluon when an electron and positron are annihalated. Non-Derived SVG of Image:Radiate_gluon.png, updated by User:joelholdsworth. == Licensing == {{self2|GFDL|cc-by-2.5}}
Bu faylda fotoaparat və ya skanerlə əlavə olunmuş məlumatlar var. Əgər fayl sonradan redaktə olunubsa, bəzi parametrlər bu şəkildə göstərilənlərdən fərqli ola bilər.
Genişlik
400
Hündürlük
250
Aprel 21, 2023
fayl, feynmann, diagram, gluon, radiation, fayl, faylın, tarixçəsi, fayl, keçidləri, faylın, qlobal, istifadəsi, metaməlumatlarbu, faylın, formatındakı, görünüşünün, ölçüsü, piksel, digər, ölçülər, piksel, piksel, piksel, piksel, piksel, faylın, orijinalı, 820. Fayl Faylin tarixcesi Fayl kecidleri Faylin qlobal istifadesi MetamelumatlarBu SVG faylin PNG formatindaki bu gorunusunun olcusu 400 250 piksel Diger olculer 320 200 piksel 640 400 piksel 1 024 640 piksel 1 280 800 piksel 2 560 1 600 piksel Faylin orijinali 8206 SVG fayli nominal olaraq 400 250 piksel faylin olcusu 2 KB Bu fayl Vikimedia Commons dadirve diger layihelerde istifade edile biler Faylin tesvir sehifesine get Xulase IzahFeynmann Diagram Gluon Radiation svg English A Feynman diagram showing the radiation of a gluon when an electron and positron are annihilated Deutsch Ein Feynman Diagramm dass die Strahlung eines Gluons bei Annihilation eines Elektrons und eines Positrons darstellt Espanol Un diagrama de Feynman mostrando la produccion de un gluon cuando un electron y un positron son aniquilados Francais nbsp Emission d un gluon lors de l annihilation d un electron et d un positron Tarix 9 mart 2007 Menbe Non Derived SVG of Radiate gluon png originally the work of SilverStar at Feynmann diagram gluon radiation svg updated by joelholdsworth Muellif Joel Holdsworth Joelholdsworth Icaze Faylin tekrar istifadesi Public domain Public domain false false This chart is ineligible for copyright and therefore in the public domain because it consists entirely of information that is common property and contains no original authorship For more information see Commons Threshold of originality nbsp Charts العربية nbsp Deutsch nbsp English nbsp francais nbsp italiano nbsp makedonski nbsp romană nbsp russkij nbsp 中文 nbsp SVG nbsp genesisInfoField nbsp The SVG code is valid nbsp This diagram was created with unknown tool nbsp This diagram uses embedded text nbsp that can be easily translated using a text editor CaptionsazerbaycancaAdd a one line explanation of what this file representsingilisA Feynman diagram describing gluon radiation in which an electron e and a positron e collide form a photon g before decaying into an anti quark quark pair Eventually the anti quark releases a gluon Simple EnglishA Fundamental Feynman Diagram sequence described below sadelesmis cin湮灭erebصورة تخطيطية لمخطط فاينمان حيث يبين التآثر الشديد بين الإلكترونات و الكواركات و ضديداتهاfransizDessin cree par Feynmann pour indiquer les reactions entre les electrons et les Quarkstayaephnphaphifnaemnthiaesdngthungkaraephkluxxnemuxxielktrxnaelaophsitrxnchnknhindव न शItems portrayed in this filetesvir edirRicard Feynmanyaranma tarixi9 mart 2007MIME type nbsp ingilisimage svg xml Faylin tarixcesi Faylin evvelki versiyasini gormek ucun gun tarix bolmesindeki tarixlere klikleyin Tarix VaxtKicik sekilOlculerIstifadeciSerh indiki07 04 28 yanvar 2021400 250 2 KB Mrmwarrow direction 01 12 28 yanvar 2021279 178 6 KB TorshianReverted to version as of 22 27 22 March 2015 UTC 20 04 8 yanvar 2021400 250 2 KB Mrmwvalid simpler code 22 27 22 mart 2015279 178 6 KB QuogleReverted to version as of 11 25 10 February 2013 11 20 8 mart 2015279 144 8 KB OCCullensThe arrow of time points in the wrong direction Look at the arrows on the electron and positron they 039 re not annihilating the electron is interacting with the quark 11 25 10 fevral 2013279 178 6 KB Maschenmake t for time italic it 039 s a variable also convert gamma for photon to times new roman in curves not as text clearer and nicer to see it that way rather than the hideous default font 09 01 16 dekabr 2012279 178 5 KB MaschenMake the coil cleaner and more uniform for the gluon 18 50 18 iyun 2011300 200 29 KB QuibikRemoved italics from the electron symbol Unstretched t 16 44 9 mart 2007300 200 30 KB Joelholdsworth commonswiki Summary A Feynmann diagram showing the radiation of a gluon when an electron and positron are annihalated Non Derived SVG of Image Radiate gluon png originally the work of de User SilverStar updated by User joelholdsworth Lice 16 35 9 mart 2007300 180 23 KB Joelholdsworth commonswiki Summary A Feynmann diagram showing the radiation of a gluon when an electron and positron are annihalated Non Derived SVG of Image Radiate gluon png updated by User joelholdsworth Licensing self2 GFDL cc by 2 5 Fayl kecidleri Bu sekile olan kecidler Feynman diaqrami Faylin qlobal istifadesi Bu fayl asagidaki vikilerde istifade olunur ar wikipedia org layihesinde istifadesi نظرية الحقل الكمومي غلوون حقل الفيزياء مخطط فاينمان تكميم فيزياء ديناميكا لونية كمية آلية هيغز قالب نظرية الحقل الكمومي قائمة نظريات الحقل الكمومي كهروديناميكا كمية نظرية المقياس بوزون غولدستون بوابة الفيزياء مقالة مختارة أرشيف بوابة الفيزياء مقالة مختارة 6 انزياح لامب التناظر في ميكانيكا الكم علم الكون الكمي نظرية المقياس الشبكي تاريخ نظرية الحقل الكمومي بداهة كمية وظيفة بيتا فيزياء مجال حر نظرية الحقل الشبكي مقدمة في نظرية القياس التصوير بالألوان فيزياء azb wikipedia org layihesinde istifadesi قلئؤون beta wikiversity org layihesinde istifadesi ਕ ਆ ਟਮ ਭ ਤ ਕ ਵ ਗ ਆਨ be wikipedia org layihesinde istifadesi Dyyagramy Fejnmana bg wikipedia org layihesinde istifadesi Richard Fajnman bn wikipedia org layihesinde istifadesi ফ ইনম য ন চ ত র ক য ন ট ম ক ষ ত র তত ত ব ট মপ ল ট ক য ন ট ম ক ষ ত র তত ত ব গ ল য ন ca wikipedia org layihesinde istifadesi Electromagnetisme Gluo Retrocausalitat cy wikipedia org layihesinde istifadesi Nodyn Theorimaescwantwm de wikipedia org layihesinde istifadesi Quantenmechanik Benutzer Stnktr Retrokausalitat de wikibooks org layihesinde istifadesi Quantenmechanik Messungen el wikipedia org layihesinde istifadesi Gkloyonio Diagramma Fainman Kbantikh 8ewria pedioy Protypo Kbantikh 8ewria pedioy E3iswsh Klain Gkornton E3iswsh Ntirak Kbantikh hlektrodynamikh en wikipedia org layihesinde istifadesi Casimir effect Freeman Dyson Feynman diagram Bu faylin qlobal istifadesine baxin Metamelumatlar Bu faylda fotoaparat ve ya skanerle elave olunmus melumatlar var Eger fayl sonradan redakte olunubsa bezi parametrler bu sekilde gosterilenlerden ferqli ola biler Genislik400Hundurluk250 Menbe https az wikipedia org wiki Fayl Feynmann Diagram Gluon Radiation svg, wikipedia, oxu, kitab, kitabxana, axtar, tap, hersey,
ne axtarsan burda
, en yaxsi meqale sayti, meqaleler, kitablar, oyrenmek, wiki, bilgi, tarix, seks, porno, indir, yukle, sex, azeri sex, azeri, seks yukle, sex yukle, izle, seks izle, porno izle, mobil seks, telefon ucun, chat, azeri chat, tanisliq, tanishliq, azeri tanishliq, sayt, medeni, medeni saytlar, chatlar, mekan, tanisliq mekani, mekanlari, yüklə, pulsuz, pulsuz yüklə, mp3, video, mp4, 3gp, jpg, jpeg, gif, png, şəkil, muisiqi, mahnı, kino, film, kitab, oyun, oyunlar.