Bu fayl "Vikimedia Commons"dadır və digər layihələrdə istifadə edilə bilər.
Faylın təsvir səhifəsinə get
Xülasə
İzahFarrukhsiyar of India.jpg
English: Farrukhsiyar of India.
Tarix
19 century
date QS:P,+1850-00-00T00:00:00Z/7
Mənbə
Cropped from File:A standing portrait of the Mughal Emperor Farrukhsiyar.jpg
Müəllif
Company School
Lisenziya
Bu şəkil, təsviri incəsənət əsərinin orijinal ikiölçülü dəqiq fotoqrafiya reproduksiyasıdır. Təsviri incəsənətin bu əsəri öz-özlüyündə aşağıdakı səbəblərdən ictimai varidat sayılır:
Public domainPublic domainfalsefalse
https://creativecommons.org/publicdomain/mark/1.0/PDMCreative Commons Public Domain Mark 1.0falsefalse
"Vikimedia Fondu" tutduğu rəsmi mövqe ondan ibarətdir ki, "ictimai varidat olan təsviri incəsənət əsərlərinin ikiölçülü dəqiq reproduksiyaları da ictimai varidat sayılır". Ətraflı məlumat almaq üçün Commons:When to use the PD-Art tag məqaləsinə baxın. Beləliklə bu fotoqrafiya reproduksiyası ictimai varidat hesab edilir. Xahiş edirik nəzərə alın ki, yerli qanunvericilikdən asılı olaraq bu məzmunun təkrar istifadəsi qadağandır və ya sizin yurisdiksiyanızda bu məzmun məhdudlaşdırılmış ola bilər. Commons:Reuse of PD-Art photographs məqaləsinə baxın.
Public domainPublic domainfalsefalse
Faylın tarixçəsi
Faylın əvvəlki versiyasını görmək üçün gün/tarix bölməsindəki tarixlərə klikləyin.
Bu faylda fotoaparat və ya skanerlə əlavə olunmuş məlumatlar var. Əgər fayl sonradan redaktə olunubsa, bəzi parametrlər bu şəkildə göstərilənlərdən fərqli ola bilər.
Orientasiya
Normal
Proqram təminatı
Microsoft Windows Photo Gallery 6.0.6000.16386
Faylın dəyişməsi tarixi və vaxtı
20:45, 9 noyabr 2013
Unique image ID
A10A06EC4E334B5798A96340F8CB7083
Aprel 03, 2024
fayl, farrukhsiyar, india, fayl, faylın, tarixçəsi, fayl, keçidləri, faylın, qlobal, istifadəsi, metaməlumatlarsınaq, göstərişi, ölçüsü, piksel, digər, ölçülər, piksel, piksel, faylın, orijinalı, 8206, piksel, fayl, həcmi, mime, növü, image, jpeg, fayl, vikime. Fayl Faylin tarixcesi Fayl kecidleri Faylin qlobal istifadesi MetamelumatlarSinaq gosterisi olcusu 398 600 piksel Diger olculer 159 240 piksel 499 752 piksel Faylin orijinali 8206 499 752 piksel fayl hecmi 108 KB MIME novu image jpeg Bu fayl Vikimedia Commons dadirve diger layihelerde istifade edile biler tesvir sehifesi Faylin tesvir sehifesine get Xulase IzahFarrukhsiyar of India jpg English Farrukhsiyar of India Tarix 19 century date QS P 1850 00 00T00 00 00Z 7 Menbe Cropped from File A standing portrait of the Mughal Emperor Farrukhsiyar jpg Muellif Company School Lisenziya Bu sekil tesviri incesenet eserinin orijinal ikiolculu deqiq fotoqrafiya reproduksiyasidir Tesviri incesenetin bu eseri oz ozluyunde asagidaki sebeblerden ictimai varidat sayilir Public domain Public domain false false This work is in the public domain in its country of origin and other countries and areas where the copyright term is the author s life plus 100 years or fewer You must also include a United States public domain tag to indicate why this work is in the public domain in the United States This file has been identified as being free of known restrictions under copyright law including all related and neighboring rights https creativecommons org publicdomain mark 1 0 PDM Creative Commons Public Domain Mark 1 0 false false Vikimedia Fondu tutdugu resmi movqe ondan ibaretdir ki ictimai varidat olan tesviri incesenet eserlerinin ikiolculu deqiq reproduksiyalari da ictimai varidat sayilir Etrafli melumat almaq ucun Commons When to use the PD Art tag meqalesine baxin Belelikle bu fotoqrafiya reproduksiyasi ictimai varidat hesab edilir Xahis edirik nezere alin ki yerli qanunvericilikden asili olaraq bu mezmunun tekrar istifadesi qadagandir ve ya sizin yurisdiksiyanizda bu mezmun mehdudlasdirilmis ola biler Commons Reuse of PD Art photographs meqalesine baxin Public domain Public domain false false This work is in the public domain in India because its term of copyright has expired The Indian Copyright Act applies in India to works first published in India According to the Indian Copyright Act 1957 as amended up to Act No 27 of 2012 Chapter V Section 25 Anonymous works photographs cinematographic works sound recordings government works and works of corporate authorship or of international organizations enter the public domain 60 years after the date on which they were first published counted from the beginning of the following calendar year i e as of 2024 works published prior to 1 January 1964 are considered public domain Posthumous works other than those above enter the public domain after 60 years from publication date counted from the beginning of the following calendar year Any kind of work other than the above enters the public domain 60 years after the author s death or in the case of a multi author work the death of the last surviving author counted from the beginning of the following calendar year Text of laws judicial opinions and other government reports are free from copyright The Indian Copyright Act 1957 is not retroactive so any work in which copyright did not subsist when it commenced did not have its copyright restored and is in the public domain per the Copyright Act 1911 You must also include a United States public domain tag to indicate why this work is in the public domain in the United States nbsp Note that this work might not be in the public domain in countries that do not apply the rule of the shorter term and have copyright terms longer than life of the author plus 60 years In particular Mexico is 100 years Jamaica is 95 years Colombia is 80 years Guatemala and Samoa are 75 years and Switzerland and the United States are 70 years العربي ة nbsp ব ল nbsp Deutsch nbsp English nbsp francais nbsp ह न द nbsp italiano nbsp 日本語 nbsp ಕನ ನಡ nbsp makedonski nbsp മലയ ള nbsp मर ठ nbsp Nederlands nbsp portugues do Brasil nbsp sicilianu nbsp தம ழ nbsp ತ ಳ nbsp اردو nbsp 繁體中文 nbsp Faylin tarixcesi Faylin evvelki versiyasini gormek ucun gun tarix bolmesindeki tarixlere klikleyin Tarix VaxtKicik sekilOlculerIstifadeciSerh indiki17 48 11 noyabr 2013499 752 108 KB TRAJAN 117User created page with UploadWizard Fayl kecidleri Asagidaki sehife bu fayli istifade edir Boyuk Mogol imperiyasi hokmdarlarinin siyahisi Faylin qlobal istifadesi Bu fayl asagidaki vikilerde istifade olunur bn wikipedia org layihesinde istifadesi ম ঘল স ম র জ য ম ঘল সম র ট br wikipedia org layihesinde istifadesi Impalaerien Vogol cs wikipedia org layihesinde istifadesi Seznam mughalskych cisaru en wikipedia org layihesinde istifadesi 1710s 1719 List of emperors of the Mughal Empire List of Indian monarchs Mughal Empire List of monarchs of Kashmir List of monarchs of Punjab es wikipedia org layihesinde istifadesi Imperio mogol Dinastia timurida Emperador mogol fa wikipedia org layihesinde istifadesi فهرست پادشاهان گورکانی هند fr wikipedia org layihesinde istifadesi Liste des empereurs moghols hi wikipedia org layihesinde istifadesi म ग ल स म र ज य म ग ल श सक क स च भ रत य सम र ट क स च hi wikibooks org layihesinde istifadesi मध यक ल न भ रत म ग ल व श id wikipedia org layihesinde istifadesi Kekaisaran Mughal 1526 1857 Daftar Kaisar Mughal Farrukhsiyar ja wikipedia org layihesinde istifadesi ムガル帝国 ムガル帝国の君主 ko wikipedia org layihesinde istifadesi 무굴 황제 mr wikipedia org layihesinde istifadesi म गल ne wikipedia org layihesinde istifadesi म गल स म र ज य pa wikipedia org layihesinde istifadesi ਮ ਗ ਲ ਬ ਦਸ ਹ pnb wikipedia org layihesinde istifadesi مغلیا سلطنت مغل بادشاہاں دی لسٹ مغل بادشاہ ہندوستان دے مسلمان حکمراناں دی تریخ ترک سلطنتاں تے ریاستاں دی تریخ sl wikipedia org layihesinde istifadesi Mogulski cesarji ta wikipedia org layihesinde istifadesi ம கல யப ப ரரச th wikipedia org layihesinde istifadesi rayphranamckrphrrdiaehngckrwrrdiomkul tr wikipedia org layihesinde istifadesi Babur Imparatorlugu hukumdarlari ur wikipedia org layihesinde istifadesi مغلیہ سلطنت مغلیہ سلطنت کے حکمرانوں کی فہرست uz wikipedia org layihesinde istifadesi Boburiy imperatorlarMetamelumatlar Bu faylda fotoaparat ve ya skanerle elave olunmus melumatlar var Eger fayl sonradan redakte olunubsa bezi parametrler bu sekilde gosterilenlerden ferqli ola biler OrientasiyaNormalProqram teminatiMicrosoft Windows Photo Gallery 6 0 6000 16386Faylin deyismesi tarixi ve vaxti20 45 9 noyabr 2013Unique image IDA10A06EC4E334B5798A96340F8CB7083 Menbe https az wikipedia org wiki Fayl Farrukhsiyar of India jpg, wikipedia, oxu, kitab, kitabxana, axtar, tap, hersey,
ne axtarsan burda
, en yaxsi meqale sayti, meqaleler, kitablar, oyrenmek, wiki, bilgi, tarix, seks, porno, indir, yukle, sex, azeri sex, azeri, seks yukle, sex yukle, izle, seks izle, porno izle, mobil seks, telefon ucun, chat, azeri chat, tanisliq, tanishliq, azeri tanishliq, sayt, medeni, medeni saytlar, chatlar, mekan, tanisliq mekani, mekanlari, yüklə, pulsuz, pulsuz yüklə, mp3, video, mp4, 3gp, jpg, jpeg, gif, png, şəkil, muisiqi, mahnı, kino, film, kitab, oyun, oyunlar.