A composed satellite photograph of Asia in orthographic projection
This is NASA "Blue Marble" image applied as a texture on a sphere using Art of Illusion program. The observer is centered at (40° N, 85° E), at Moon distance above the Earth.
Public domainPublic domainfalsefalse
See also Image:Asia Globe NASA.jpg for an image rendered with "night" over Europe and specular reflection.
derivative works
Derivative works of this file:
Západní Sibiř.png
Post-Soviet satellite orthographic.jpg
de:Image:Asia satellite orthographic.jpg
Captions
Add a one-line explanation of what this file represents
Items portrayed in this file
təsvir edir
MIME type ingilis
image/jpeg
Faylın tarixçəsi
Faylın əvvəlki versiyasını görmək üçün gün/tarix bölməsindəki tarixlərə klikləyin.
A composed satellite photograph of Asia in orthographic projection This is NASA [http://visibleearth.nasa.gov/view_rec.php?vev1id=11656 "Blue Marble"] image applied as a texture on a sphere using
fayl, asia, satellite, orthographic, fayl, faylın, tarixçəsi, istifadə, edilən, səhifələr, faylın, qlobal, istifadəsisınaq, göstərişi, ölçüsü, piksel, digər, ölçülər, piksel, piksel, piksel, piksel, piksel, faylın, orijinalı, 8206, piksel, fayl, həcmi, mime, n. Fayl Faylin tarixcesi Istifade edilen sehifeler Faylin qlobal istifadesiSinaq gosterisi olcusu 577 600 piksel Diger olculer 231 240 piksel 462 480 piksel 739 768 piksel 985 1 024 piksel 1 887 1 962 piksel Faylin orijinali 8206 1 887 1 962 piksel fayl hecmi 855 KB MIME novu image jpeg Bu fayl Vikimedia Commons dadirve diger layihelerde istifade edile biler Faylin tesvir sehifesine get ssaaannynyryasasssssssnwnwnywngwwwwmswwsimimwykhtphiiraninrywwwswswkrrmthanhwngphxsnxng Xulase A composed satellite photograph of Asia in orthographic projectionThis is NASA Blue Marble archive copy image applied as a texture on a sphere using Art of Illusion program The observer is centered at 40 N 85 E at Moon distance above the Earth Public domain Public domain false falseThis file is in the public domain in the United States because it was solely created by NASA NASA copyright policy states that NASA material is not protected by copyright unless noted See Template PD USGov NASA copyright policy page or JPL Image Use Policy Warnings Use of NASA logos insignia and emblems is restricted per U S law 14 CFR 1221 The NASA website hosts a large number of images from the Soviet Russian space agency and other non American space agencies These are not necessarily in the public domain Materials based on Hubble Space Telescope data may be copyrighted if they are not explicitly produced by the STScI 1 See also PD Hubble and Cc Hubble The SOHO ESA amp NASA joint project implies that all materials created by its probe are copyrighted and require permission for commercial non educational use 2 Images featured on the Astronomy Picture of the Day APOD web site may be copyrighted 3 The National Space Science Data Center NSSDC site has been known to host copyrighted content Its photo gallery FAQ states that all of the images in the photo gallery are in the public domain Unless otherwise noted See also Image Asia Globe NASA jpg for an image rendered with night over Europe and specular reflection derivative works Derivative works of this file Zapadni Sibir png Post Soviet satellite orthographic jpgde Image Asia satellite orthographic jpgCaptionsazerbaycancaAdd a one line explanation of what this file representsItems portrayed in this filetesvir edirMIME type ingilisimage jpeg Faylin tarixcesi Faylin evvelki versiyasini gormek ucun gun tarix bolmesindeki tarixlere klikleyin Tarix VaxtKicik sekilOlculerIstifadeciSerh indiki11 33 19 aprel 20051 887 1 962 855 KB GhalasA composed satellite photograph of Asia in orthographic projection This is NASA http visibleearth nasa gov view rec php vev1id 11656 Blue Marble image applied as a texture on a sphere using Istifade edilen sehifeler Bu sekile olan kecidler Asiya Asiya faunasi Turk tarixi Faylin qlobal istifadesi Bu fayl asagidaki vikilerde istifade olunur af wikipedia org layihesinde istifadesi Asie ar wikipedia org layihesinde istifadesi بوابة ماكاو بوابة ماكاو بوابات شقيقة ar wikinews org layihesinde istifadesi بوابة آسيا ast wikipedia org layihesinde istifadesi Asia bar wikipedia org layihesinde istifadesi Portal Eadkund ba wikipedia org layihesinde istifadesi Aziya be tarask wikipedia org layihesinde istifadesi Aziya be wikipedia org layihesinde istifadesi Aziya bg wikipedia org layihesinde istifadesi Geografiya na Aziya bg wiktionary org layihesinde istifadesi Aziya bh wikipedia org layihesinde istifadesi एश य क भ ग ल blk wikipedia org layihesinde istifadesi အ သ bn wikipedia org layihesinde istifadesi এশ য র ভ গ ল bo wikipedia org layihesinde istifadesi ཨ ཤ ཡ bpy wikipedia org layihesinde istifadesi এশ য br wikipedia org layihesinde istifadesi Azia br wiktionary org layihesinde istifadesi Azia bs wikipedia org layihesinde istifadesi Azija ca wikipedia org layihesinde istifadesi Asia ca wikiquote org layihesinde istifadesi Asia ceb wikipedia org layihesinde istifadesi Asya co wikipedia org layihesinde istifadesi Asia csb wikipedia org layihesinde istifadesi Azejo cy wikipedia org layihesinde istifadesi Asia Daearyddiaeth Asia de wikipedia org layihesinde istifadesi Asien Geschichte Asiens Fussball in Russland Portal Asien Fussball in Japan Fussball in Syrien Benutzer Muffingg Fussball in Australien Fussball in Armenien Portal Asien Inhalte Fussball in der Turkei Fussball Benutzer Oezkan Benutzer Kuemmjen Landerliste Benutzer Moooob Benutzer Vorlage aus Asien Wikipedia Diskussion WikiProjekt Geographie Archiv 2008 1 Fussball in Thailand Benutzer Xakio7 Wikipedia Einbander Abbildungen Benutzerin Chandravathanaa Koreanisches Olympisches Komitee Fussball in Pakistan Benutzer Dimon NN Bu faylin qlobal istifadesine baxin Menbe https az wikipedia org wiki Fayl Asia satellite orthographic jpg, wikipedia, oxu, kitab, kitabxana, axtar, tap, hersey,
ne axtarsan burda
, en yaxsi meqale sayti, meqaleler, kitablar, oyrenmek, wiki, bilgi, tarix, seks, porno, indir, yukle, sex, azeri sex, azeri, seks yukle, sex yukle, izle, seks izle, porno izle, mobil seks, telefon ucun, chat, azeri chat, tanisliq, tanishliq, azeri tanishliq, sayt, medeni, medeni saytlar, chatlar, mekan, tanisliq mekani, mekanlari, yüklə, pulsuz, pulsuz yüklə, mp3, video, mp4, 3gp, jpg, jpeg, gif, png, şəkil, muisiqi, mahnı, kino, film, kitab, oyun, oyunlar.
