fbpx
Wikipedia

Alamgir II of India

Alamgir_II_of_India.jpg(318 × 433 piksel, fayl həcmi: 55 KB, MIME növü: image/jpeg)

Bu fayl "Vikimedia Commons"dadır
və digər layihələrdə istifadə edilə bilər.
Faylın təsvir səhifəsinə get
Emperor Alamgir II   (  )
Artist
Sukha Luhar
Başlıq
Emperor Alamgir II
Tarix circa 1756
date QS:P571,+1756-00-00T00:00:00Z/9,P1480,Q5727902
Orta gouache on paper
Ölçülər Hündürlük: 18,3 sm; eni: 13,3 sm
dimensions QS:P2048,18.3U174728
dimensions QS:P2049,13.3U174728
institution QS:P195,Q632682
Current location
Asian Art collection
Accession number
78.256.5
Credit line Anonymous gift.
Source/Photographer Online Collection of Brooklyn Museum; Photo: Brooklyn Museum, 78.256.5_IMLS_PS3.jpg
İcazə
(Faylın təkrar istifadəsi)
This image was uploaded by the Brooklyn Museum as a content partnership, and is considered to have no known copyright restrictions by the institutions of the Brooklyn Museum.

Note: While the Brooklyn Museum cannot make an absolute statement on copyright status for legal reasons, it supports and encourages the Wikimedia community in researching and applying the copyright status tag that is most appropriate for their purposes.

Lisenziya

Bu şəkil, təsviri incəsənət əsərinin orijinal ikiölçülü dəqiq fotoqrafiya reproduksiyasıdır. Təsviri incəsənətin bu əsəri öz-özlüyündə aşağıdakı səbəblərdən ictimai varidat sayılır:
"Vikimedia Fondu" tutduğu rəsmi mövqe ondan ibarətdir ki, "ictimai varidat olan təsviri incəsənət əsərlərinin ikiölçülü dəqiq reproduksiyaları da ictimai varidat sayılır". Ətraflı məlumat almaq üçün Commons:When to use the PD-Art tag məqaləsinə baxın.
Beləliklə bu fotoqrafiya reproduksiyası ictimai varidat hesab edilir. Xahiş edirik nəzərə alın ki, yerli qanunvericilikdən asılı olaraq bu məzmunun təkrar istifadəsi qadağandır və ya sizin yurisdiksiyanızda bu məzmun məhdudlaşdırılmış ola bilər. Commons:Reuse of PD-Art photographs məqaləsinə baxın.

Faylın tarixçəsi

Faylın əvvəlki versiyasını görmək üçün gün/tarix bölməsindəki tarixlərə klikləyin.

Tarix/VaxtKiçik şəkilÖlçülərİstifadəçiŞərh
indiki09:17, 2 fevral 2014318 × 433 (55 KB)TRAJAN 117Reverted to version as of 13:05, 15 January 2014
14:34, 27 yanvar 2014356 × 571 (51 KB)GryffindorReverted to version as of 14:46, 7 January 2014
13:05, 15 yanvar 2014318 × 433 (55 KB)TRAJAN 117Reverted to version as of 16:38, 11 November 2013
14:46, 7 yanvar 2014356 × 571 (51 KB)Gryffindor{{Information |Description= |Source={{own}} |Date= |Author= Gryffindor |Permission= |other_versions= }}
16:38, 11 noyabr 2013318 × 433 (55 KB)TRAJAN 117User created page with UploadWizard

Faylın qlobal istifadəsi

Bu fayl aşağıdakı vikilərdə istifadə olunur:

  • মুঘল সম্রাট
  • Alamdžír Šáh II.
  • 1699
  • Mughal emperors
  • Mughal Empire
  • Dinastía timúrida
  • Emperador mogol
  • मुग़ल शासकों की सूची
  • भारतीय सम्राटों की सूची
  • hi.wikibooks.org layihəsində istifadəsi
    • मध्यकालीन भारत/मुग़ल वंश
  • Daftar Kaisar Mughal
  • مغل بادشاہاں دی لسٹ
  • مغل بادشاہ
  • ہندوستان دے مسلمان حکمراناں دی تریخ
  • ترک سلطنتاں تے ریاستاں دی تریخ
  • Список глав государств в 1755 году
  • Список глав государств в 1756 году
  • Список глав государств в 1757 году
  • Список глав государств в 1758 году
  • Список глав государств в 1759 году
  • Alamgir II
  • Metaməlumatlar

    fayl, alamgir, india, fayl, faylın, tarixçəsi, fayl, keçidləri, faylın, qlobal, istifadəsi, metaməlumatlardaha, yüksək, versiyası, yoxdur, alamgir, india, 8206, piksel, fayl, həcmi, mime, növü, image, jpeg, fayl, vikimedia, commons, dadırvə, digər, layihələrdə. Fayl Faylin tarixcesi Fayl kecidleri Faylin qlobal istifadesi MetamelumatlarDaha yuksek versiyasi yoxdur Alamgir II of India jpg 8206 318 433 piksel fayl hecmi 55 KB MIME novu image jpeg Bu fayl Vikimedia Commons dadirve diger layihelerde istifade edile biler Faylin tesvir sehifesine get Emperor Alamgir II nbsp nbsp nbsp Artist Sukha Luhar Basliq Emperor Alamgir II Tarix circa 1756 date QS P571 1756 00 00T00 00 00Z 9 P1480 Q5727902 Orta gouache on paper Olculer Hundurluk 18 3 sm eni 13 3 smdimensions QS P2048 18 3U174728dimensions QS P2049 13 3U174728 Collection Brooklyn Museum nbsp nbsp Native name Brooklyn Museum Parent institution New York Art Resources Consortium nbsp Location Nyu York Coordinates 40 nbsp 40 nbsp 16 7 nbsp N 73 nbsp 57 nbsp 49 5 nbsp W nbsp Established 1895 nbsp Veb sayt www brooklynmuseum org Normativ yoxlama Q632682 VIAF 265104231 ISNI 0000 0004 0381 232X ULAN 500304292 LCCN n79063288 GND 1023174 2 WorldCat institution QS P195 Q632682 Current location Asian Art collection Accession number 78 256 5 Credit line Anonymous gift Source Photographer Online Collection of Brooklyn Museum Photo Brooklyn Museum 78 256 5 IMLS PS3 jpg Icaze Faylin tekrar istifadesi This image was uploaded by the Brooklyn Museum as a content partnership and is considered to have no known copyright restrictions by the institutions of the Brooklyn Museum Note While the Brooklyn Museum cannot make an absolute statement on copyright status for legal reasons it supports and encourages the Wikimedia community in researching and applying the copyright status tag that is most appropriate for their purposes No known copyright restrictions No restrictions commons wikimedia org wiki File Alamgir II of India jpg false Lisenziya Bu sekil tesviri incesenet eserinin orijinal ikiolculu deqiq fotoqrafiya reproduksiyasidir Tesviri incesenetin bu eseri oz ozluyunde asagidaki sebeblerden ictimai varidat sayilir Public domain Public domain false false This work is in the public domain in its country of origin and other countries and areas where the copyright term is the author s life plus 100 years or fewer You must also include a United States public domain tag to indicate why this work is in the public domain in the United States This file has been identified as being free of known restrictions under copyright law including all related and neighboring rights https creativecommons org publicdomain mark 1 0 PDM Creative Commons Public Domain Mark 1 0 false false Vikimedia Fondu tutdugu resmi movqe ondan ibaretdir ki ictimai varidat olan tesviri incesenet eserlerinin ikiolculu deqiq reproduksiyalari da ictimai varidat sayilir Etrafli melumat almaq ucun Commons When to use the PD Art tag meqalesine baxin Belelikle bu fotoqrafiya reproduksiyasi ictimai varidat hesab edilir Xahis edirik nezere alin ki yerli qanunvericilikden asili olaraq bu mezmunun tekrar istifadesi qadagandir ve ya sizin yurisdiksiyanizda bu mezmun mehdudlasdirilmis ola biler Commons Reuse of PD Art photographs meqalesine baxin Faylin tarixcesi Faylin evvelki versiyasini gormek ucun gun tarix bolmesindeki tarixlere klikleyin Tarix VaxtKicik sekilOlculerIstifadeciSerh indiki09 17 2 fevral 2014318 433 55 KB TRAJAN 117Reverted to version as of 13 05 15 January 2014 14 34 27 yanvar 2014356 571 51 KB GryffindorReverted to version as of 14 46 7 January 2014 13 05 15 yanvar 2014318 433 55 KB TRAJAN 117Reverted to version as of 16 38 11 November 2013 14 46 7 yanvar 2014356 571 51 KB Gryffindor Information Description Source own Date Author Gryffindor Permission other versions 16 38 11 noyabr 2013318 433 55 KB TRAJAN 117User created page with UploadWizard Fayl kecidleri Bu sekile olan kecidler Boyuk Mogol imperiyasi hokmdarlarinin siyahisi Faylin qlobal istifadesi Bu fayl asagidaki vikilerde istifade olunur bn wikipedia org layihesinde istifadesi ম ঘল স ম র জ য ম ঘল সম র ট br wikipedia org layihesinde istifadesi Impalaerien Vogol cs wikipedia org layihesinde istifadesi Seznam mughalskych cisaru Alamdzir Sah II en wikipedia org layihesinde istifadesi 1690s 1699 Mughal emperors Mughal Empire es wikipedia org layihesinde istifadesi Imperio mogol Dinastia timurida Emperador mogol fa wikipedia org layihesinde istifadesi فهرست پادشاهان گورکانی هند fr wikipedia org layihesinde istifadesi Liste des empereurs moghols hi wikipedia org layihesinde istifadesi म ग ल स म र ज य म ग ल श सक क स च भ रत य सम र ट क स च hi wikibooks org layihesinde istifadesi मध यक ल न भ रत म ग ल व श id wikipedia org layihesinde istifadesi Kesultanan Mughal Daftar Kaisar Mughal ja wikipedia org layihesinde istifadesi ムガル帝国の君主 ko wikipedia org layihesinde istifadesi 무굴 바드샤 mr wikipedia org layihesinde istifadesi म गल ne wikipedia org layihesinde istifadesi म गल स म र ज य pa wikipedia org layihesinde istifadesi ਮ ਗ ਲ ਬ ਦਸ ਹ ਦ ਸ ਚ pnb wikipedia org layihesinde istifadesi مغلیا سلطنت مغل بادشاہاں دی لسٹ مغل بادشاہ ہندوستان دے مسلمان حکمراناں دی تریخ ترک سلطنتاں تے ریاستاں دی تریخ pt wikipedia org layihesinde istifadesi Lista de imperadores mogois ru wikipedia org layihesinde istifadesi Alamgir II Spisok glav gosudarstv v 1755 godu Spisok glav gosudarstv v 1756 godu Spisok glav gosudarstv v 1757 godu Spisok glav gosudarstv v 1758 godu Spisok glav gosudarstv v 1759 godu sl wikipedia org layihesinde istifadesi Mogulski cesarji sv wikipedia org layihesinde istifadesi Alamgir II ta wikipedia org layihesinde istifadesi ம கல யப ப ரரச th wikipedia org layihesinde istifadesi rayphranamckrphrrdiaehngckrwrrdiomkul tr wikipedia org layihesinde istifadesi Babur Imparatorlugu hukumdarlari ur wikipedia org layihesinde istifadesi مغلیہ سلطنت کے حکمرانوں کی فہرست uz wikipedia org layihesinde istifadesi Boburiy imperatorlar vi wikipedia org layihesinde istifadesi Nha Timur Alamgir IIMetamelumatlar Bu faylda fotoaparat ve ya skanerle elave olunmus melumatlar var Eger fayl sonradan redakte olunubsa bezi parametrler bu sekilde gosterilenlerden ferqli ola biler OrientasiyaNormalFaylin deyismesi tarixi ve vaxti21 04 9 noyabr 2013Unique image ID67EA2E6BC0544EDB82EB999572963236Proqram teminatiMicrosoft Windows Photo Gallery 6 0 6000 16386 Menbe https az wikipedia org wiki Fayl Alamgir II of India jpg, wikipedia, oxu, kitab, kitabxana, axtar, tap, hersey,

    ne axtarsan burda

    , en yaxsi meqale sayti, meqaleler, kitablar, oyrenmek, wiki, bilgi, tarix, seks, porno, indir, yukle, sex, azeri sex, azeri, seks yukle, sex yukle, izle, seks izle, porno izle, mobil seks, telefon ucun, chat, azeri chat, tanisliq, tanishliq, azeri tanishliq, sayt, medeni, medeni saytlar, chatlar, mekan, tanisliq mekani, mekanlari, yüklə, pulsuz, pulsuz yüklə, mp3, video, mp4, 3gp, jpg, jpeg, gif, png, şəkil, muisiqi, mahnı, kino, film, kitab, oyun, oyunlar.