Cropped from File:The Emperor Ahmad Shah, equestrian, in the hunting field 1750 San Diego Museum of Art.jpg
Lisenziya
Bu şəkil, təsviri incəsənət əsərinin orijinal ikiölçülü dəqiq fotoqrafiya reproduksiyasıdır. Təsviri incəsənətin bu əsəri öz-özlüyündə aşağıdakı səbəblərdən ictimai varidat sayılır:
Public domainPublic domainfalsefalse
https://creativecommons.org/publicdomain/mark/1.0/PDMCreative Commons Public Domain Mark 1.0falsefalse
"Vikimedia Fondu" tutduğu rəsmi mövqe ondan ibarətdir ki, "ictimai varidat olan təsviri incəsənət əsərlərinin ikiölçülü dəqiq reproduksiyaları da ictimai varidat sayılır". Ətraflı məlumat almaq üçün Commons:When to use the PD-Art tag məqaləsinə baxın. Beləliklə bu fotoqrafiya reproduksiyası ictimai varidat hesab edilir. Xahiş edirik nəzərə alın ki, yerli qanunvericilikdən asılı olaraq bu məzmunun təkrar istifadəsi qadağandır və ya sizin yurisdiksiyanızda bu məzmun məhdudlaşdırılmış ola bilər. Commons:Reuse of PD-Art photographs məqaləsinə baxın.
{{PD-Art}} template without license parameter: please specify why the underlying work is public domain in both the source country and the United States (Usage: {{PD-Art|1=|deathyear=''year of author's death''|country=''source country''}}, where parameter #1 can be PD-old-auto, PD-old-auto-expired, PD-old-auto-1996, PD-old-100 or similar. See Commons:Multi-license copyright tags for more information.)
Captions
Add a one-line explanation of what this file represents
Items portrayed in this file
təsvir edir
MIME type ingilis
image/jpeg
checksum ingilis
dec412709ddc8ad30eb151622afb1cfe2fc50268
determination method ingilis: SHA-1 ingilis
data size ingilis
63.296 Bayt
hündürlüyü/boyu
429 piksel
eni
299 piksel
Faylın tarixçəsi
Faylın əvvəlki versiyasını görmək üçün gün/tarix bölməsindəki tarixlərə klikləyin.
Bu faylda fotoaparat və ya skanerlə əlavə olunmuş məlumatlar var. Əgər fayl sonradan redaktə olunubsa, bəzi parametrlər bu şəkildə göstərilənlərdən fərqli ola bilər.
Kamera istehsalçısı
NIKON
Kamera modeli
E990
Exposure time
5/506 saniyə (0,0098814229249012)
F nömrəsi
f/4,5
ISO sürət reytinqi
100
Orijinal tarix və vaxt
15:55, 2 oktyabr 2001
Fokus məsafəsi
15,5 mm
Təmin edici
Gift of Dr. and Mrs. Edwin Binne
Orientasiya
Normal
Üfüqi xətt
300 dpi
Şaquli xətt
300 dpi
Proqram təminatı
Microsoft Windows Photo Gallery 6.0.6000.16386
Faylın dəyişməsi tarixi və vaxtı
16:11, 11 noyabr 2013
Y və C komponetlərinə görə yerləşmə sırası
Co-sited
Ekspozisiya proqramı
Normal proqram
Exif versiyası
2.1
Tarix və vaxt rəqəmləşdirilir
15:55, 2 oktyabr 2001
Meaning of each component
Y
Cb
Cr
mövcud deyil
Image compression mode
1
APEX shutter speed
6,643856
Obyektiv gözü
4,33985
APEX exposure bias
0
Maximum land aperture
3,5 APEX (f/3,36)
Metering mode
Dizaynlı
İşıq mənbəsi
Tungsten (incandescent light)
Flaş
Flaş yandırılmadı
Supported Flashpix version
1
Rəng sahəsi
sRGB
Fayl mənbəsi
Rəqəmsal fotoapparat
Səhnə tipi
Foto-təsvir birbaşa çəkilmişdir
Unique image ID
0A4662712DD642E2825BBE34C3E29C29
IIM versiya
4
Date metadata was last modified
07:30, 6 sentyabr 2011
Unique ID of original document
71275A4D4717815A0ABF0503D661B636
Oktyabr 18, 2023
fayl, ahmad, shah, bahadur, india, fayl, faylın, tarixçəsi, fayl, keçidləri, faylın, qlobal, istifadəsi, metaməlumatlardaha, yüksək, versiyası, yoxdur, ahmad, shah, bahadur, india, 8206, piksel, fayl, həcmi, mime, növü, image, jpeg, fayl, vikimedia, commons, d. Fayl Faylin tarixcesi Fayl kecidleri Faylin qlobal istifadesi MetamelumatlarDaha yuksek versiyasi yoxdur Ahmad Shah Bahadur of India jpg 8206 299 429 piksel fayl hecmi 62 KB MIME novu image jpeg Bu fayl Vikimedia Commons dadirve diger layihelerde istifade edile biler tesvir sehifesi Faylin tesvir sehifesine get Xulase Artist Unknown Izah English Ahmad Shah Bahadur of India Tarix Circa 1750 Collection San Diego Museum of Art nbsp nbsp Native name San Diego Museum of Art Location San Diego California Coordinates 32 nbsp 43 nbsp 56 03 nbsp N 117 nbsp 09 nbsp 01 69 nbsp W nbsp Established 28 fevral 1926 as The Fine Arts Gallery of San Diego present name 1978 Veb sayt www sdmart org Normativ yoxlama Q1368166 VIAF 169497881 ISNI 0000 0004 0635 9014 ULAN 500308532 Open Library OL7004093A LCCN n79093181 WorldCat institution QS P195 Q1368166 Accession number 1990 384 Source Photographer Cropped from File The Emperor Ahmad Shah equestrian in the hunting field 1750 San Diego Museum of Art jpg Lisenziya Bu sekil tesviri incesenet eserinin orijinal ikiolculu deqiq fotoqrafiya reproduksiyasidir Tesviri incesenetin bu eseri oz ozluyunde asagidaki sebeblerden ictimai varidat sayilir Public domain Public domain false false This work is in the public domain in its country of origin and other countries and areas where the copyright term is the author s life plus 70 years or fewer You must also include a United States public domain tag to indicate why this work is in the public domain in the United States nbsp Note that a few countries have copyright terms longer than 70 years Mexico has 100 years Jamaica has 95 years Colombia has 80 years and Guatemala and Samoa have 75 years This image may not be in the public domain in these countries which moreover do not implement the rule of the shorter term Honduras has a general copyright term of 75 years but it does implement the rule of the shorter term Copyright may extend on works created by French who died for France in World War II more information Russians who served in the Eastern Front of World War II known as the Great Patriotic War in Russia and posthumously rehabilitated victims of Soviet repressions more information This file has been identified as being free of known restrictions under copyright law including all related and neighboring rights https creativecommons org publicdomain mark 1 0 PDM Creative Commons Public Domain Mark 1 0 false false Vikimedia Fondu tutdugu resmi movqe ondan ibaretdir ki ictimai varidat olan tesviri incesenet eserlerinin ikiolculu deqiq reproduksiyalari da ictimai varidat sayilir Etrafli melumat almaq ucun Commons When to use the PD Art tag meqalesine baxin Belelikle bu fotoqrafiya reproduksiyasi ictimai varidat hesab edilir Xahis edirik nezere alin ki yerli qanunvericilikden asili olaraq bu mezmunun tekrar istifadesi qadagandir ve ya sizin yurisdiksiyanizda bu mezmun mehdudlasdirilmis ola biler Commons Reuse of PD Art photographs meqalesine baxin PD Art template without license parameter please specify why the underlying work is public domain in both the source country and the United States Usage PD Art 1 deathyear year of author s death country source country where parameter 1 can be PD old auto PD old auto expired PD old auto 1996 PD old 100 or similar See Commons Multi license copyright tags for more information CaptionsazerbaycancaAdd a one line explanation of what this file representsItems portrayed in this filetesvir edirMIME type nbsp ingilisimage jpegchecksum nbsp ingilisdec412709ddc8ad30eb151622afb1cfe2fc50268determination method nbsp ingilis SHA 1 nbsp ingilisdata size nbsp ingilis63 296 Baythundurluyu boyu429 pikseleni299 piksel Faylin tarixcesi Faylin evvelki versiyasini gormek ucun gun tarix bolmesindeki tarixlere klikleyin Tarix VaxtKicik sekilOlculerIstifadeciSerh indiki16 12 11 noyabr 2013299 429 62 KB TRAJAN 117 16 09 11 noyabr 2013299 429 62 KB TRAJAN 117User created page with UploadWizard Fayl kecidleri Bu sekile olan kecidler Boyuk Mogol imperiyasi hokmdarlarinin siyahisi Faylin qlobal istifadesi Bu fayl asagidaki vikilerde istifade olunur bn wikipedia org layihesinde istifadesi ম ঘল সম র ট br wikipedia org layihesinde istifadesi Impalaerien Vogol cs wikipedia org layihesinde istifadesi Seznam mughalskych cisaru en wikipedia org layihesinde istifadesi Mughal emperors List of Indian monarchs Mughal Empire List of monarchs of Kashmir List of monarchs of Punjab es wikipedia org layihesinde istifadesi Imperio mogol Dinastia timurida Emperador mogol fa wikipedia org layihesinde istifadesi فهرست پادشاهان گورکانی هند fr wikipedia org layihesinde istifadesi Liste des empereurs moghols hi wikipedia org layihesinde istifadesi म ग ल स म र ज य म ग ल श सक क स च भ रत य सम र ट क स च hi wikibooks org layihesinde istifadesi मध यक ल न भ रत म ग ल व श id wikipedia org layihesinde istifadesi Kesultanan Mughal Daftar Kaisar Mughal ja wikipedia org layihesinde istifadesi ムガル帝国 ムガル帝国の君主 ko wikipedia org layihesinde istifadesi 무굴 황제 mr wikipedia org layihesinde istifadesi म गल ne wikipedia org layihesinde istifadesi म गल स म र ज य pa wikipedia org layihesinde istifadesi ਮ ਗ ਲ ਬ ਦਸ ਹ pnb wikipedia org layihesinde istifadesi مغلیا سلطنت مغل بادشاہاں دی لسٹ مغل بادشاہ ہندوستان دے مسلمان حکمراناں دی تریخ ترک سلطنتاں تے ریاستاں دی تریخ pt wikipedia org layihesinde istifadesi Lista de imperadores mogois sl wikipedia org layihesinde istifadesi Mogulski cesarji ta wikipedia org layihesinde istifadesi ம கல யப ப ரரச th wikipedia org layihesinde istifadesi rayphranamckrphrrdiaehngckrwrrdiomkul tr wikipedia org layihesinde istifadesi Babur Imparatorlugu hukumdarlari ur wikipedia org layihesinde istifadesi مغلیہ سلطنت مغلیہ سلطنت کے حکمرانوں کی فہرست uz wikipedia org layihesinde istifadesi Boburiy imperatorlar vi wikipedia org layihesinde istifadesi Đế quốc TimurMetamelumatlar Bu faylda fotoaparat ve ya skanerle elave olunmus melumatlar var Eger fayl sonradan redakte olunubsa bezi parametrler bu sekilde gosterilenlerden ferqli ola biler Kamera istehsalcisiNIKONKamera modeliE990Exposure time5 506 saniye 0 0098814229249012 F nomresif 4 5ISO suret reytinqi100Orijinal tarix ve vaxt15 55 2 oktyabr 2001Fokus mesafesi15 5 mmTemin ediciGift of Dr and Mrs Edwin BinneOrientasiyaNormalUfuqi xett300 dpiSaquli xett300 dpiProqram teminatiMicrosoft Windows Photo Gallery 6 0 6000 16386Faylin deyismesi tarixi ve vaxti16 11 11 noyabr 2013Y ve C komponetlerine gore yerlesme sirasiCo sitedEkspozisiya proqramiNormal proqramExif versiyasi2 1Tarix ve vaxt reqemlesdirilir15 55 2 oktyabr 2001Meaning of each componentY Cb Cr movcud deyilImage compression mode1APEX shutter speed6 643856Obyektiv gozu4 33985APEX exposure bias0Maximum land aperture3 5 APEX f 3 36 Metering modeDizaynliIsiq menbesiTungsten incandescent light FlasFlas yandirilmadiSupported Flashpix version1Reng sahesisRGBFayl menbesiReqemsal fotoapparatSehne tipiFoto tesvir birbasa cekilmisdirUnique image ID0A4662712DD642E2825BBE34C3E29C29IIM versiya4Date metadata was last modified07 30 6 sentyabr 2011Unique ID of original document71275A4D4717815A0ABF0503D661B636 Menbe https az wikipedia org wiki Fayl Ahmad Shah Bahadur of India jpg, wikipedia, oxu, kitab, kitabxana, axtar, tap, hersey,
ne axtarsan burda
, en yaxsi meqale sayti, meqaleler, kitablar, oyrenmek, wiki, bilgi, tarix, seks, porno, indir, yukle, sex, azeri sex, azeri, seks yukle, sex yukle, izle, seks izle, porno izle, mobil seks, telefon ucun, chat, azeri chat, tanisliq, tanishliq, azeri tanishliq, sayt, medeni, medeni saytlar, chatlar, mekan, tanisliq mekani, mekanlari, yüklə, pulsuz, pulsuz yüklə, mp3, video, mp4, 3gp, jpg, jpeg, gif, png, şəkil, muisiqi, mahnı, kino, film, kitab, oyun, oyunlar.
